PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10012545
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 77aa    MW: 8410.72 Da    PI: 10.3978
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10012545genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.73.2e-281058250
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                 +ie+ks rqvtfskR+ g+lKKA+ELSvLC++evav+ifs  gklye+s
  Lus10012545 10 PIEDKSTRQVTFSKRKRGLLKKAQELSVLCGVEVAVVIFSGGGKLYEFS 58
                 79**********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.2E-34160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.002161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-27261IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-25323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.8E-261157IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 77 aa     Download sequence    Send to blast
MGRGKVEMRP IEDKSTRQVT FSKRKRGLLK KAQELSVLCG VEVAVVIFSG GGKLYEFSGG  60
ERYIVSSNSN SILYHS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-17161161Myocyte-specific enhancer factor 2B
1tqe_R1e-17161161Myocyte-specific enhancer factor 2B
1tqe_Q1e-17161161Myocyte-specific enhancer factor 2B
1tqe_P1e-17161161Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002300117.16e-27hypothetical protein POPTR_0001s33600g
SwissprotQ388371e-24AGL13_ARATH; Agamous-like MADS-box protein AGL13
TrEMBLB9GF416e-27B9GF41_POPTR; Uncharacterized protein
STRINGPOPTR_0001s33600.12e-26(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61120.16e-26AGAMOUS-like 13